PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 214aa    MW: 22890.9 Da    PI: 8.3914
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023906genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601444.3e-4581071100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk+FGasnv+kll++l++++reda++sl+y+A++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ +k
  DCAR_023906   8 PCAACKFLRRKCQPECVFAPYFPPDQPQKFASVHKVFGASNVTKLLNELHPHQREDAVNSLAYQADMRIRDPVYGCVGVISLLQHQLRQLQMDLSCAK 105
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  DCAR_023906 106 SE 107
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0127108IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-448105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MASASNSPCA ACKFLRRKCQ PECVFAPYFP PDQPQKFASV HKVFGASNVT KLLNELHPHQ  60
REDAVNSLAY QADMRIRDPV YGCVGVISLL QHQLRQLQMD LSCAKSELSK YQNHHIGGVG  120
VGVGGGSITS HSLIAAAAAA AAATSHQNLG INLIGNGGTG SPVPYHHHQF FPHQQQVIRT  180
FDGTTMSYDA SNLLGMGPMS QFPQPRVAGG DER*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.18e-99PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.18e-99PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.18e-99PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.18e-99PREDICTED: LOB domain-containing protein 6
SwissprotO044792e-77LBD6_ARATH; LOB domain-containing protein 6
TrEMBLD7SSJ39e-99D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t012e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-66LBD family protein